PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400030218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 255aa    MW: 28576 Da    PI: 9.554
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400030218genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.62.6e-313483150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fss+g+lyey+
  PGSC0003DMP400030218 34 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYA 83
                          79***********************************************8 PP

2K-box92.29.2e-31101192394
                 K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                           ++s+ s++ea+++++qqe++kL+++i+ +q+ +R+++Ge L+sLs ++L++Le +Lek++ ++RskKnell+++ie +qk+  e+++++
  PGSC0003DMP400030218 101 STSTGSVSEANTQYYQQEASKLRRQIRDIQTYNRQIVGEALSSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKRIAEVERAQ 189
                           4556669*****************************************************************************99998 PP

                 K-box  92 kaL 94 
                           +++
  PGSC0003DMP400030218 190 EQM 192
                           875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-402685IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.0392686IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-3327102IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-332848IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002882IPR002100Transcription factor, MADS-box
CDDcd002659.66E-4330103No hitNo description
PfamPF003195.9E-263582IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-334863IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-336384IPR002100Transcription factor, MADS-box
PfamPF014861.0E-21110193IPR002487Transcription factor, K-box
PROSITE profilePS5129712.725112215IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MVFPNNQELL VDESSSQLRK TGAGGGGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL  60
SVLCDAEVSL IVFSSRGRLY EYANNSVRAT IDRYKKHHAD STSTGSVSEA NTQYYQQEAS  120
KLRRQIRDIQ TYNRQIVGEA LSSLSPRDLK NLEGKLEKAI GRVRSKKNEL LFSEIELMQK  180
RIAEVERAQE QMNLMPGGGG GGGGGSDQYH HQPNYEDARN NFLPVNLLEP NPHYSRRDDG  240
DQTPLQLVYA SLPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-2027111188Myocyte-specific enhancer factor 2A
3p57_I2e-2027111188Myocyte-specific enhancer factor 2A
3p57_D2e-2027111188Myocyte-specific enhancer factor 2A
3p57_C2e-2027111188Myocyte-specific enhancer factor 2A
3p57_B2e-2027111188Myocyte-specific enhancer factor 2A
3p57_A2e-2027111188Myocyte-specific enhancer factor 2A
3kov_J2e-2027111188Myocyte-specific enhancer factor 2A
3kov_I2e-2027111188Myocyte-specific enhancer factor 2A
3kov_B2e-2027111188Myocyte-specific enhancer factor 2A
3kov_A2e-2027111188Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987350.0AY098735.2 Lycopersicon esculentum TAGL1 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348940.11e-165PREDICTED: floral homeotic protein AGAMOUS-like
RefseqXP_006348941.11e-165PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ408724e-97AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLM1BGD10.0M1BGD1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000445520.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.11e-86MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]